PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AA53G01052
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Aethionemeae; Aethionema
Family MYB
Protein Properties Length: 608aa    MW: 67720.7 Da    PI: 8.0986
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AA53G01052genomeVEGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding55.51.3e-171461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g WT+eEd +++ +v+ +G g+W++I+++ g++R++k+c++rw +yl
       AA53G01052 14 KGLWTAEEDAKILAYVAIHGVGNWSLIPKKAGLNRCGKSCRLRWTNYL 61
                     678*******************************************97 PP

2Myb_DNA-binding52.89.1e-1769110346
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      +++++E+el+++++k  G++ W+tIar+++ gRt++++k++w++
       AA53G01052  69 SFSPQEEELIIQCHKIIGSR-WSTIARKLP-GRTDNDVKNHWNT 110
                      79******************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.606.8E-25564IPR009057Homeodomain-like
PROSITE profilePS5129427.406965IPR017930Myb domain
SuperFamilySSF466891.47E-3011108IPR009057Homeodomain-like
SMARTSM007174.9E-161363IPR001005SANT/Myb domain
PfamPF002497.4E-161461IPR001005SANT/Myb domain
CDDcd001672.37E-121761No hitNo description
Gene3DG3DSA:1.10.10.602.9E-2365117IPR009057Homeodomain-like
PROSITE profilePS5129419.59266116IPR017930Myb domain
SMARTSM007174.7E-1566114IPR001005SANT/Myb domain
CDDcd001677.34E-1169112No hitNo description
PfamPF002495.4E-1469110IPR001005SANT/Myb domain
Gene3DG3DSA:3.40.50.1503.0E-46398601IPR029063S-adenosyl-L-methionine-dependent methyltransferase
SuperFamilySSF533352.2E-27406598IPR029063S-adenosyl-L-methionine-dependent methyltransferase
PfamPF036029.3E-47406598No hitNo description
CDDcd024400.00975455542No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 608 aa     Download sequence    Send to blast
MGRPPCCDKS NVKKGLWTAE EDAKILAYVA IHGVGNWSLI PKKAGLNRCG KSCRLRWTNY  60
LRPDLKHDSF SPQEEELIIQ CHKIIGSRWS TIARKLPGRT DNDVKNHWNT KLKKKLIKMG  120
IDPVTHKPVS QVLSEYRNIS SHGNSSNPSE HFVRNLKTTL IHDPEQSNSV LTQSITAWEI  180
MRNTSHESYN SMIFTNSPSS EFPSPYLFSN QSNHLLNAAT SSCSSSSSSA SITQPNSGDS  240
LQLQAQAQAN TFCWNDFLIS DPISPLSSPQ PEQLETEVIV SSATSDLVCV QESHCNKSSQ  300
DITSKASGTC HSTISFVDEI LEREQEMIST RPLRIRKSAI TVVSSRKSSG LASEDRKLLL  360
ERYGYDANDF APETKKTRRK EEQKSGKSSL QEEEVPVQPR TTHRLLQVLA GTAKRKKLLS  420
LKGMDVRPMM EVVKGAAFGI LQAAGGCPTS LRPGRWLDLY SGTGSVGIEA ISRGCSEAHF  480
VEMDPWVVSN VLQLNLEHTG FVDASVIHTA RVENFLERAD EVVGMSCKDE AFDYISVTPP  540
YMEVDYEVLM DQISKSAVIG ENTFIVVEYP SRTTMLDSCG SLEKMTDRRF GRTHLAIYGP  600
KWAQKPRK
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A4e-29141167108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY0743600.0AY074360.1 Arabidopsis thaliana unknown protein (At3g28460) mRNA, complete cds.
GenBankAY1425810.0AY142581.1 Arabidopsis thaliana unknown protein (At3g28460) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
SwissprotQ9LSI71e-132MYB35_ARATH; Transcription factor MYB35
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G28470.11e-127MYB family protein